abczdrowie.pl

Trusted High Traffic Tranco #8,985

abczdrowie.pl operates primarily as a content publishing platform, focusing on health information portal. abczdrowie.pl is a comprehensive Polish online portal offering extensive information on health, diseases, symptoms, treatments, and healthy lifestyles. It also provides services such as doctor search and online consultations. It is operated by Wirtualna Polska Media S.A., a subsidiary of Wirtualna Polska Holding S.A..

Industry Category

Content Publishing

Platforms for creating and publishing written content.

Related Topics

healthmedicinewellnesslifestylepolandhealthcare services

Well Established

abczdrowie.pl is a well-established platform operated by Wirtualna Polska Media S.A.. Top 100,000 global website, 17 years old. Standard web safety practices apply.

Top 100,000 global website17 years old
Real-Time Investigation

Investigate a Specific URL

Run a live threat scan to detect phishing, malware, and suspicious content on any URL from this domain.

Opens in a new tab for live analysis

Recent Threat Analysis

URLert analyzed recent scan activity for abczdrowie.pl

No public scans recorded recently

Be the first to run a threat analysis on this domain.

Developer API

Integrate Domain Intelligence

Access this classification data programmatically via our API.

GET /api/v1/classify?domain=abczdrowie.pl
{
  "domain": "abczdrowie.pl",
  "confidence": "medium",
  "category": {
    "purpose": "content_publishing",
    "specialization": "Health Information Portal"
  },
  "identity": {
    "headline": "Leading Polish online health and medical information portal",
    "summary": "abczdrowie.pl is a comprehensive Polish online portal offering extensive information on health, diseases, symptoms, treatments, and healthy lifestyles. It also provides services such as doctor search and online consultations.",
    "operator": "Wirtualna Polska Media S.A.",
    "parent_entity": "Wirtualna Polska Holding S.A.",
    "topics": [
      "health",
      "medicine",
      "wellness",
      "lifestyle",
      "poland",
      "healthcare services"
    ]
  },
  "functions": {
    "is_ugc_platform": false,
    "is_file_host": false,
    "is_url_shortener": false,
    "is_public_idp": false,
    "is_crypto_platform": false,
    "allows_user_subdomains": false,
    "is_form_builder": false,
    "is_document_host": false
  },
  "facts": {
    "registered_date": "2008-01-31T00:00:00Z",
    "rank": 8985,
    "hosting_provider": "O2-AS Wirtualna Polska Media S.A."
  }
}

Hosting

O2-AS Wirtualna Polska Media S.A.

Registered

Jan 31, 2008

Last Updated

Jan 8, 2026

Domain data sourced from WHOIS, Tranco rankings, and URLert's classification engine.