abczdrowie.pl operates primarily as a content publishing platform, focusing on health information portal. abczdrowie.pl is a comprehensive Polish online portal offering extensive information on health, diseases, symptoms, treatments, and healthy lifestyles. It also provides services such as doctor search and online consultations. It is operated by Wirtualna Polska Media S.A., a subsidiary of Wirtualna Polska Holding S.A..
abczdrowie.pl
Trusted High Traffic Tranco #8,985
Related Topics
healthmedicinewellnesslifestylepolandhealthcare services
Well Established
abczdrowie.pl is a well-established platform operated by Wirtualna Polska Media S.A.. Top 100,000 global website, 17 years old. Standard web safety practices apply.
Top 100,000 global website17 years old
Real-Time Investigation
Investigate a Specific URL
Run a live threat scan to detect phishing, malware, and suspicious content on any URL from this domain.
Opens in a new tab for live analysis
Recent Threat Analysis
URLert analyzed recent scan activity for abczdrowie.pl
No public scans recorded recently
Be the first to run a threat analysis on this domain.
Developer API
Integrate Domain Intelligence
Access this classification data programmatically via our API.
GET /api/v1/classify?domain=abczdrowie.pl
{
"domain": "abczdrowie.pl",
"confidence": "medium",
"category": {
"purpose": "content_publishing",
"specialization": "Health Information Portal"
},
"identity": {
"headline": "Leading Polish online health and medical information portal",
"summary": "abczdrowie.pl is a comprehensive Polish online portal offering extensive information on health, diseases, symptoms, treatments, and healthy lifestyles. It also provides services such as doctor search and online consultations.",
"operator": "Wirtualna Polska Media S.A.",
"parent_entity": "Wirtualna Polska Holding S.A.",
"topics": [
"health",
"medicine",
"wellness",
"lifestyle",
"poland",
"healthcare services"
]
},
"functions": {
"is_ugc_platform": false,
"is_file_host": false,
"is_url_shortener": false,
"is_public_idp": false,
"is_crypto_platform": false,
"allows_user_subdomains": false,
"is_form_builder": false,
"is_document_host": false
},
"facts": {
"registered_date": "2008-01-31T00:00:00Z",
"rank": 8985,
"hosting_provider": "O2-AS Wirtualna Polska Media S.A."
}
}