mobile.de operates primarily as a marketplace, focusing on vehicle marketplace. mobile.de is the leading online vehicle marketplace in Germany, providing a platform for buying and selling new and used cars, motorcycles, and commercial vehicles. It connects private sellers and dealers with potential buyers across the country. It is operated by mobile.de GmbH, a subsidiary of Adevinta.
mobile.de
Trusted High Traffic Tranco #2,003
Related Topics
carsvehiclesmarketplaceclassifiedsautomotivegermany
Well Established
mobile.de is a well-established platform operated by mobile.de GmbH. Top 10,000 global website, unknown registration date, high traffic. Standard web safety practices apply.
Top 10,000 global websiteunknown registration datehigh traffic
Security Considerations
While mobile.de is an established platform, these capabilities require extra vigilance.
User-Generated Content
mobile.de hosts content created by its users, not the platform operator. Individual posts, profiles, or pages may contain scams, misinformation, or phishing attempts that the platform hasn't yet detected or removed.
Remember: The platform itself is established, but even established platforms can be abused.
Real-Time Investigation
Investigate a Specific URL
Run a live threat scan to detect phishing, malware, and suspicious content on any URL from this domain.
Opens in a new tab for live analysis
Recent Threat Analysis
URLert analyzed recent scan activity for mobile.de and found 1 result.
| Status | Target URL | Time |
|---|---|---|
| Clean | https://m.mobile.de/fahrzeuge/details.html | 4 weeks ago |
Developer API
Integrate Domain Intelligence
Access this classification data programmatically via our API.
GET /api/v1/classify?domain=mobile.de
{
"domain": "mobile.de",
"state": "developed",
"stability": "stable",
"confidence": "medium",
"category": {
"purpose": "marketplace",
"specialization": "Vehicle Marketplace",
"secondary_purposes": []
},
"identity": {
"headline": "Germany's largest online marketplace for vehicles",
"summary": "mobile.de is the leading online vehicle marketplace in Germany, providing a platform for buying and selling new and used cars, motorcycles, and commercial vehicles. It connects private sellers and dealers with potential buyers across the country.",
"operator": "mobile.de GmbH",
"parent_entity": "Adevinta",
"topics": [
"cars",
"vehicles",
"marketplace",
"classifieds",
"automotive",
"germany"
]
},
"functions": {
"is_ugc_platform": true,
"is_file_host": false,
"is_url_shortener": false,
"is_public_idp": false,
"is_crypto_platform": false,
"allows_user_subdomains": false,
"is_form_builder": false,
"is_document_host": false
},
"facts": {
"created_at": null,
"rank": 2003,
"hosting_provider": "AMAZON-02"
}
}