nettiauto.com operates primarily as a marketplace, focusing on vehicle classifieds. Nettiauto.com is Finland's largest online marketplace for buying and selling new and used cars, motorcycles, and other vehicles. It serves as a platform connecting private sellers and dealerships with potential buyers across the country. It is operated by Alma Media.
nettiauto.com
Trusted High Traffic Tranco #9,153
Related Topics
carsvehiclesmarketplaceclassifiedsfinlandautomotive
Well Established
nettiauto.com is a well-established platform operated by Alma Media. Top 10,000 global website, 25 years old, high traffic. Standard web safety practices apply.
Top 10,000 global website25 years oldhigh traffic
Security Considerations
While nettiauto.com is an established platform, these capabilities require extra vigilance.
User-Generated Content
nettiauto.com hosts content created by its users, not the platform operator. Individual posts, profiles, or pages may contain scams, misinformation, or phishing attempts that the platform hasn't yet detected or removed.
Remember: The platform itself is established, but even established platforms can be abused.
Real-Time Investigation
Investigate a Specific URL
Run a live threat scan to detect phishing, malware, and suspicious content on any URL from this domain.
Opens in a new tab for live analysis
Recent Threat Analysis
URLert analyzed recent scan activity for nettiauto.com
No public scans recorded recently
Be the first to run a threat analysis on this domain.
Developer API
Integrate Domain Intelligence
Access this classification data programmatically via our API.
GET /api/v1/classify?domain=nettiauto.com
{
"domain": "nettiauto.com",
"state": "developed",
"stability": "permanent",
"confidence": "medium",
"category": {
"purpose": "marketplace",
"specialization": "Vehicle Classifieds",
"secondary_purposes": []
},
"identity": {
"headline": "Finland's largest online marketplace for new and used vehicles",
"summary": "Nettiauto.com is Finland's largest online marketplace for buying and selling new and used cars, motorcycles, and other vehicles. It serves as a platform connecting private sellers and dealerships with potential buyers across the country.",
"operator": "Alma Media",
"parent_entity": null,
"topics": [
"cars",
"vehicles",
"marketplace",
"classifieds",
"finland",
"automotive"
]
},
"functions": {
"is_ugc_platform": true,
"is_file_host": false,
"is_url_shortener": false,
"is_public_idp": false,
"is_crypto_platform": false,
"allows_user_subdomains": false,
"is_form_builder": false,
"is_document_host": false
},
"facts": {
"created_at": "2000-08-24",
"rank": 9153,
"hosting_provider": "CLOUDFLARENET"
}
}