ss.com operates primarily as a marketplace, focusing on online classifieds. SS.COM is the largest classifieds website in Latvia, offering a wide range of categories for buying, selling, and exchanging goods and services. It serves as a primary platform for private and commercial advertisements in the region. It is operated by SS.COM.
ss.com
Trusted High Traffic Tranco #1,631
Related Topics
classifiedsmarketplaceadvertisinglatviaecommerce
Well Established
ss.com is a well-established platform operated by SS.COM. Top 10,000 global website, 28 years old, high traffic. Standard web safety practices apply.
Top 10,000 global website28 years oldhigh traffic
Security Considerations
While ss.com is an established platform, these capabilities require extra vigilance.
User-Generated Content
ss.com hosts content created by its users, not the platform operator. Individual posts, profiles, or pages may contain scams, misinformation, or phishing attempts that the platform hasn't yet detected or removed.
Remember: The platform itself is established, but even established platforms can be abused.
Real-Time Investigation
Investigate a Specific URL
Run a live threat scan to detect phishing, malware, and suspicious content on any URL from this domain.
Opens in a new tab for live analysis
Recent Threat Analysis
URLert analyzed recent scan activity for ss.com
No public scans recorded recently
Be the first to run a threat analysis on this domain.
Developer API
Integrate Domain Intelligence
Access this classification data programmatically via our API.
GET /api/v1/classify?domain=ss.com
{
"domain": "ss.com",
"state": "developed",
"stability": "permanent",
"confidence": "medium",
"category": {
"purpose": "marketplace",
"specialization": "Online Classifieds",
"secondary_purposes": []
},
"identity": {
"headline": "Latvian online classifieds and advertising portal",
"summary": "SS.COM is the largest classifieds website in Latvia, offering a wide range of categories for buying, selling, and exchanging goods and services. It serves as a primary platform for private and commercial advertisements in the region.",
"operator": "SS.COM",
"parent_entity": null,
"topics": [
"classifieds",
"marketplace",
"advertising",
"latvia",
"ecommerce"
]
},
"functions": {
"is_ugc_platform": true,
"is_file_host": false,
"is_url_shortener": false,
"is_public_idp": false,
"is_crypto_platform": false,
"allows_user_subdomains": false,
"is_form_builder": false,
"is_document_host": false
},
"facts": {
"created_at": "1997-06-06",
"rank": 1631,
"hosting_provider": "INTERNETLTD INTERNET Ltd."
}
}