ss.lv operates primarily as a marketplace, focusing on online classifieds. SS.LV is the leading online classifieds website in Latvia, providing a platform for users to post and browse advertisements for a wide variety of goods, services, real estate, vehicles, and jobs. It facilitates local buying and selling for individuals and businesses. It is operated by Internet.
ss.lv
Trusted High Traffic Tranco #8,903
Related Topics
classifiedsmarketplacelatviaadsecommercereal estatevehiclesjobs
Well Established
ss.lv is a well-established platform operated by Internet. Top 10,000 global website, unknown registration date, high traffic. Standard web safety practices apply.
Top 10,000 global websiteunknown registration datehigh traffic
Security Considerations
While ss.lv is an established platform, these capabilities require extra vigilance.
File Hosting
ss.lv allows users to upload and share files. Any file you download was uploaded by another user—not the platform operator. Scan downloads with antivirus software and only download from sources you trust.
User-Generated Content
ss.lv hosts content created by its users, not the platform operator. Individual posts, profiles, or pages may contain scams, misinformation, or phishing attempts that the platform hasn't yet detected or removed.
Remember: The platform itself is established, but even established platforms can be abused.
Related Security Guides
Learn about common risks for this type of website
Real-Time Investigation
Investigate a Specific URL
Run a live threat scan to detect phishing, malware, and suspicious content on any URL from this domain.
Opens in a new tab for live analysis
Recent Threat Analysis
URLert analyzed recent scan activity for ss.lv
No public scans recorded recently
Be the first to run a threat analysis on this domain.
Developer API
Integrate Domain Intelligence
Access this classification data programmatically via our API.
GET /api/v1/classify?domain=ss.lv
{
"domain": "ss.lv",
"state": "developed",
"stability": "stable",
"confidence": "high",
"category": {
"purpose": "marketplace",
"specialization": "Online Classifieds",
"secondary_purposes": []
},
"identity": {
"headline": "Latvia's largest online classifieds and advertising portal",
"summary": "SS.LV is the leading online classifieds website in Latvia, providing a platform for users to post and browse advertisements for a wide variety of goods, services, real estate, vehicles, and jobs. It facilitates local buying and selling for individuals and businesses.",
"operator": "Internet",
"parent_entity": null,
"topics": [
"classifieds",
"marketplace",
"latvia",
"ads",
"ecommerce",
"real estate",
"vehicles",
"jobs"
]
},
"functions": {
"is_ugc_platform": true,
"is_file_host": true,
"is_url_shortener": false,
"is_public_idp": false,
"is_crypto_platform": false,
"allows_user_subdomains": false,
"is_form_builder": false,
"is_document_host": false
},
"facts": {
"created_at": null,
"rank": 8903,
"hosting_provider": "INTERNETLTD INTERNET Ltd."
}
}