ad networksmalvertisingtrackingprivacysecurity
The Hidden Dangers of Online Tracking
2026-03-31 • URLert Security Team
Read Next
Anatomy of a Domain Risk Engine: Regex vs LLMs
Building a domain risk engine in 2025 requires balancing speed and accuracy. Learn how URLert's hybrid intelligence pipeline escalates threat detection from static analysis to AI agents only when necessary.
December 6, 2025
ClickFix & Fake CAPTCHA Attacks
How attackers weaponize fake CAPTCHAs and browser errors to trick you into running malware on your own computer — and how to protect yourself.
April 20, 2026