ad networksmalvertisingtrackingprivacysecurity
The Hidden Dangers of Online Tracking
2026-03-31 • URLert Security Team
Read Next
Which Hosting Providers Harbor the Most Dangerous Websites?
An analysis of 36,033 domains reveals which hosting providers harbor the most dangerous websites, with data on problematic domain rates, bad scan percentages, and threat categories.
April 3, 2026
Navigating Telegram Safely
Learn how scammers operate on Telegram, how t.me links are abused, and how to protect yourself.
May 27, 2025