affinity.net operates primarily as a corporate website, focusing on ad-tech solutions. Affinity Global Inc. is a leading ad-tech company providing privacy-friendly advertising solutions. It develops engaging ad formats and powerful software to help marketers achieve branding and performance goals through its platforms like SitePlug, VEVE, and mCanvas. It is operated by Affinity Global Inc..
affinity.net
Caution High Traffic Tranco #27,007
Related Topics
ad-techadvertisingmarketingprivacyperformance marketingbranding
Established Site
affinity.net is an established platform operated by Affinity Global Inc.. Top 100,000 global website, 27 years old, high traffic. Standard web safety practices apply.
Top 100,000 global website27 years oldhigh traffic
Real-Time Investigation
Investigate a Specific URL
Run a live threat scan to detect phishing, malware, and suspicious content on any URL from this domain.
Opens in a new tab for live analysis
Recent Threat Analysis
URLert analyzed recent scan activity for affinity.net and found 1 result.
| Status | Target URL | Time |
|---|---|---|
| Suspicious | https://ww55.affinity.net/sssdomweb | 2 days ago |
Developer API
Integrate Domain Intelligence
Access this classification data programmatically via our API.
GET /api/v1/classify?domain=affinity.net
{
"domain": "affinity.net",
"state": "developed",
"stability": "permanent",
"confidence": "medium",
"category": {
"purpose": "corporate_website",
"specialization": "Ad-tech Solutions",
"secondary_purposes": []
},
"identity": {
"headline": "Ad-tech company specializing in privacy-friendly advertising solutions.",
"summary": "Affinity Global Inc. is a leading ad-tech company providing privacy-friendly advertising solutions. It develops engaging ad formats and powerful software to help marketers achieve branding and performance goals through its platforms like SitePlug, VEVE, and mCanvas.",
"operator": "Affinity Global Inc.",
"parent_entity": null,
"topics": [
"ad-tech",
"advertising",
"marketing",
"privacy",
"performance marketing",
"branding"
]
},
"functions": {
"is_ugc_platform": false,
"is_file_host": false,
"is_url_shortener": false,
"is_public_idp": false,
"is_crypto_platform": false,
"allows_user_subdomains": false,
"is_form_builder": false,
"is_document_host": false
},
"facts": {
"created_at": "1998-10-27",
"rank": 27007,
"hosting_provider": "DIGITALOCEAN-ASN"
}
}