undresslab.ink

Analyzed 6 hours ago
Potentially Malicious Unranked
0 /100
Score

Domain Age

1 Month

Tranco Rank

Unranked

Hosting Provider

Cloudflare, Inc.

Threat History

Issues Found

Community Votes

Rate this domain:

AI Analyst Classification

undresslab.ink functions as a landing page or redirect hub for services that generate non-consensual explicit imagery. The site is primarily used to funnel users toward automated tools that facilitate harassment and the creation of harmful content.

Potentially Malicious non-consensual imagerydeepfakeharassmentmalicious service
Specialization
Non-consensual explicit content
Registered
May 15, 2026

Technical Analysis

Recent Threat Analysis

URLert analyzed recent scan activity for undresslab.ink and found 1 result.

Hosting & Network

Historical and current IP address mappings for this domain.

Community Intelligence

Discussion Threads

Share Insight

0/20+

Investigate a Link

Received a suspicious link? Paste the full link to investigate.

Frequently Asked Questions About undresslab.ink

Something wrong?
Domain owner?
Developer API

Integrate Domain Intelligence

Access this classification data programmatically via our API.

GET /api/v1/classify?domain=undresslab.ink
{
  "domain": "undresslab.ink",
  "confidence": "high",
  "category": {
    "purpose": "potentially_malicious",
    "specialization": "Non-consensual explicit content"
  },
  "identity": {
    "headline": "Platform distributing links to non-consensual explicit content generation bots",
    "summary": "undresslab.ink functions as a landing page or redirect hub for services that generate non-consensual explicit imagery. The site is primarily used to funnel users toward automated tools that facilitate harassment and the creation of harmful content.",
    "operator": null,
    "parent_entity": null,
    "topics": [
      "non-consensual imagery",
      "deepfake",
      "harassment",
      "malicious service",
      "adult content"
    ]
  },
  "functions": {
    "is_ugc_platform": false,
    "is_file_host": false,
    "is_url_shortener": false,
    "is_public_idp": false,
    "is_crypto_platform": false,
    "allows_user_subdomains": false,
    "is_form_builder": false,
    "is_document_host": false
  },
  "facts": {
    "registered_date": "2026-05-15T17:31:14Z",
    "rank": null,
    "hosting_provider": "Cloudflare, Inc."
  }
}